Skip to main content
ChemVerify
Peptides 1×1

GLP-2 (Glucagon-Like Peptide-2): Research Guide & Chemical Profile

Complete research guide to GLP-2 (Glucagon-Like Peptide-2), a 33-amino-acid intestinal growth factor. Covers GLP-2R agonism, gut mucosal repair, teduglutide analog, and short bowel syndrome research.

ChemVerify Editorial
12 min read
Published April 12, 2026

Scientific research image for GLP-2 (Glucagon-Like Peptide-2): Research Guide & Chemical Profile

For laboratory research use only. Not for human consumption.

TL;DR: GLP-2 (Glucagon-Like Peptide-2) is a 33-amino-acid peptide produced by enteroendocrine L-cells in the distal intestine through proglucagon processing. It is the primary endogenous intestinotrophic growth factor, stimulating crypt cell proliferation, villus elongation, and mucosal repair through the GLP-2 receptor (GLP-2R). Teduglutide (Gattex/Revestive), a DPP-IV-resistant GLP-2 analog, represents the clinical translation of GLP-2 biology for short bowel syndrome research.

Last verified: April 2026 | Data accuracy confirmed by ChemVerify Editorial Team

Chemical Profile & Structural Properties

GLP-2 is a 33-amino-acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD. It has a molecular weight of approximately 3,766 Da and a molecular formula of C164H249N43O55S1. GLP-2 belongs to the glucagon superfamily of peptides, sharing structural homology with glucagon, GLP-1, GIP (glucose-dependent insulinotropic peptide), and secretin. The peptide was identified through sequence analysis of the proglucagon gene and subsequent characterization of its intestinotrophic biological activity by Daniel Drucker and colleagues in the mid-1990s.

Structural analysis by circular dichroism and NMR spectroscopy reveals that GLP-2 adopts a predominantly alpha-helical conformation in membrane-mimetic environments (SDS micelles, trifluoroethanol/water). The helical region spans approximately residues 7-30, with disordered N-terminal and C-terminal segments. The alpha-helical structure is essential for receptor binding, as proline substitutions that disrupt helicity significantly reduce GLP-2R activation. The N-terminal histidine-alanine dipeptide (His1-Ala2) is critical for receptor activation but also represents the DPP-IV cleavage site responsible for rapid in vivo degradation.

Native GLP-2 has an extremely short plasma half-life of approximately 7 minutes in humans due to rapid N-terminal cleavage by dipeptidyl peptidase IV (DPP-IV). The cleavage product GLP-2(3-33) retains some receptor binding affinity but acts as an antagonist rather than an agonist, potentially functioning as an endogenous negative regulator. This rapid degradation limits the utility of native GLP-2 as a research tool and necessitated the development of DPP-IV-resistant analogs for sustained in vivo studies.

  • Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD (33 amino acids)
  • Molecular weight: ~3,766 Da
  • Molecular formula: C164H249N43O55S1
  • Gene: Proglucagon (GCG) on chromosome 2q36-q37
  • Half-life: ~7 minutes (native); ~2-3 hours (teduglutide)
  • Receptor: GLP-2R (G protein-coupled receptor)
  • Primary source: Intestinal L-cells, brainstem neurons
  • DPP-IV cleavage site: His1-Ala2 (between positions 2-3)

Biosynthesis & Proglucagon Processing

GLP-2 is produced by tissue-specific post-translational processing of the 160-amino-acid proglucagon precursor protein. In pancreatic alpha-cells, proglucagon is cleaved by prohormone convertase 2 (PC2) to release glucagon as the major bioactive product. In intestinal L-cells and brainstem neurons, the same precursor is processed by prohormone convertase 1/3 (PC1/3) to release GLP-1, GLP-2, oxyntomodulin, glicentin, and intervening peptide-2. GLP-1 and GLP-2 are co-secreted in equimolar amounts from intestinal L-cells.

GLP-2 secretion is stimulated by nutrient ingestion, particularly luminal carbohydrates and lipids. The secretory response occurs within 15-30 minutes of food intake and is mediated by both direct nutrient sensing by L-cells in the distal ileum and colon and by neural reflexes from proximal gut nutrient detection. Bile acids also stimulate GLP-2 release through TGR5 (Takeda G protein-coupled receptor 5) activation on L-cells. Fasting GLP-2 levels in human plasma are approximately 50-100 pmol/L, rising 2-3-fold postprandially.

The co-secretion of GLP-1 and GLP-2 from the same cells creates an integrated hormonal response to nutrient intake: GLP-1 promotes insulin secretion and glycemic control while GLP-2 stimulates intestinal growth and nutrient absorption. This coordinated secretion ensures that enhanced absorptive capacity is matched with appropriate metabolic hormone responses. The parallel regulation has implications for patients receiving GLP-1 receptor agonist therapy, as exogenous GLP-1R activation does not stimulate the intestinotrophic GLP-2 pathway.

GLP-2 Receptor Signaling & Distribution

The GLP-2 receptor (GLP-2R) is a class B1 (secretin family) G protein-coupled receptor encoded by the GLP2R gene. Upon GLP-2 binding, the receptor couples primarily to Gs proteins, activating adenylate cyclase and increasing intracellular cAMP. Downstream effectors include protein kinase A (PKA) and EPAC (exchange protein directly activated by cAMP), which mediate the proliferative and cytoprotective signaling cascades. GLP-2R also activates beta-arrestin signaling, which contributes to receptor internalization and may mediate distinct signaling outputs.

GLP-2R expression in the gastrointestinal tract is not localized to the epithelial cells that undergo proliferative expansion. Instead, the receptor is expressed primarily on subepithelial myofibroblasts, enteric neurons, and enteroendocrine cells. This indirect signaling architecture means that GLP-2 stimulates epithelial proliferation through paracrine mediators released from GLP-2R-expressing stromal cells. Identified paracrine mediators include keratinocyte growth factor (KGF/FGF-7), insulin-like growth factor 1 (IGF-1), and ErbB ligands produced by subepithelial myofibroblasts.

Extra-intestinal GLP-2R expression has been identified in the central nervous system (hypothalamus, brainstem), gallbladder, and lung. Central GLP-2R signaling modulates food intake and hepatic glucose production through vagal efferent pathways. The brainstem expression in the nucleus of the solitary tract and dorsal motor nucleus of the vagus suggests integration with visceral afferent information. These extra-intestinal actions expand the physiological role of GLP-2 beyond a purely intestinotrophic factor.

Intestinotrophic Effects & Mucosal Growth

The defining biological activity of GLP-2 is stimulation of intestinal mucosal growth (intestinotrophic effect). Exogenous GLP-2 administration in rodents produces dose-dependent increases in small intestinal weight, villus height, crypt depth, and mucosal cross-sectional area. The effect is most pronounced in the jejunum and proximal ileum and is primarily driven by increased crypt cell proliferation with a modest reduction in apoptosis. Villus height increases of 30-50% are typically observed after 10-14 days of continuous GLP-2 administration.

The proliferative response involves acceleration of the crypt stem cell cycle. GLP-2 treatment increases the number of cells in S-phase (DNA synthesis) within intestinal crypts, as demonstrated by BrdU incorporation and Ki-67 immunostaining. The transit-amplifying cell compartment expands, producing more daughter cells that migrate up the villus. Simultaneously, GLP-2 extends the lifespan of villus enterocytes by suppressing apoptosis at the villus tip, contributing to overall villus elongation through both increased cell production and reduced cell loss.

GLP-2 also stimulates intestinal blood flow and mesenteric perfusion, an effect mediated through nitric oxide (NO) and vasoactive intestinal peptide (VIP) signaling. Increased blood flow delivers additional nutrients and oxygen to support the expanded mucosal tissue mass. The angiogenic properties include promotion of submucosal microvessel density. These vascular effects complement the direct mucosal growth response and are important for functional integration of the increased absorptive surface area.

Intestinal Barrier Function & Permeability

GLP-2 enhances intestinal epithelial barrier function through multiple mechanisms. Tight junction protein expression, including claudins, occludin, and zonula occludens-1 (ZO-1), is upregulated by GLP-2 treatment. In vitro studies using intestinal epithelial monolayers demonstrate that GLP-2 increases transepithelial electrical resistance (TEER) and decreases paracellular permeability to macromolecular tracers. These barrier-enhancing effects occur through both transcriptional regulation of tight junction components and post-translational modification of junction protein organization.

In models of intestinal injury (ischemia-reperfusion, radiation, NSAIDs, chemotherapy), GLP-2 pretreatment or co-treatment attenuates barrier disruption and reduces bacterial translocation from the gut lumen to mesenteric lymph nodes and systemic circulation. The protective mechanism involves preservation of tight junction integrity, maintenance of mucus layer thickness through stimulation of goblet cell mucin secretion, and upregulation of Paneth cell antimicrobial peptide production (defensins, lysozyme). These innate defense mechanisms collectively reduce the risk of septic complications following intestinal injury.

Inflammatory Bowel Disease Research

GLP-2 and its analogs have been investigated in preclinical models of inflammatory bowel disease (IBD), including dextran sodium sulfate (DSS) colitis, trinitrobenzene sulfonic acid (TNBS) colitis, and IL-10 knockout spontaneous colitis. In acute colitis models, GLP-2 treatment reduced disease activity scores, attenuated colonic shortening, decreased inflammatory cell infiltration, and improved histological damage scores. The therapeutic effects involved both mucosal repair (accelerated re-epithelialization) and anti-inflammatory mechanisms (reduced mucosal TNF-alpha, IL-1beta, and IL-6 expression).

The anti-inflammatory properties of GLP-2 are partially mediated through enteric neurons expressing GLP-2R. VIP-containing neurons appear to be important effectors, as VIP is a potent anti-inflammatory neuropeptide that suppresses mucosal immune cell activation. GLP-2 also modulates intestinal macrophage phenotype, promoting an M2 (tissue repair) profile over M1 (pro-inflammatory) polarization. These immunomodulatory effects complement the direct barrier repair functions and support the concept of GLP-2 as a mucosal healing factor.

Despite promising preclinical results, clinical investigation of GLP-2 analogs in Crohn disease and ulcerative colitis has been limited. A small pilot study of teduglutide in Crohn disease showed evidence of mucosal healing in some patients but was not powered for definitive efficacy conclusions. The concern that GLP-2 trophic effects could theoretically promote dysplasia or neoplasia in chronically inflamed mucosa has also moderated enthusiasm for IBD applications, although preclinical data have not demonstrated increased cancer risk with GLP-2 treatment.

Short Bowel Syndrome & Teduglutide

Short bowel syndrome (SBS) represents the primary clinical research context for GLP-2 biology. SBS occurs when insufficient intestinal length remains after surgical resection (typically <200 cm of small intestine) to maintain adequate nutrient and fluid absorption, necessitating parenteral nutrition (PN) support. Teduglutide (Gattex in the US, Revestive in Europe), a GLP-2 analog with an Ala2Gly substitution conferring DPP-IV resistance, was developed specifically to enhance intestinal adaptation and reduce PN dependence in SBS patients.

Teduglutide has a half-life of approximately 2-3 hours compared to 7 minutes for native GLP-2, enabling once-daily subcutaneous administration. Clinical trials demonstrated that teduglutide treatment increased intestinal wet weight absorption, reduced fecal wet weight output, and enabled progressive reduction in parenteral nutrition volume and infusion frequency. In the pivotal phase III STEPS trial, 63% of teduglutide-treated patients achieved a clinically meaningful reduction (20% or greater) in parenteral support volume compared to 30% of placebo-treated patients.

The intestinal adaptation produced by teduglutide includes villus hyperplasia, increased crypt depth, and enhanced functional absorptive surface area as demonstrated by endoscopic biopsy in clinical studies. Citrulline, a plasma biomarker of enterocyte mass, increases during teduglutide treatment and correlates with clinical response. The adaptation process requires continued treatment, as discontinuation leads to gradual regression of mucosal hyperplasia and return toward baseline absorption capacity over several weeks.

DPP-IV Degradation & Analog Design

The rapid degradation of native GLP-2 by DPP-IV has driven the development of multiple stabilization strategies. The most clinically validated approach is the Ala2Gly substitution used in teduglutide, which eliminates the DPP-IV recognition motif while preserving near-full receptor agonist potency. The Gly2 substitution extends half-life approximately 20-fold while retaining >95% of native GLP-2 receptor binding affinity and cAMP signaling efficacy.

Glepaglutide is a second-generation GLP-2 analog incorporating more extensive modifications: the Ala2Gly DPP-IV resistance mutation, a C-terminal lysine residue with a fatty acid (C-18) acyl chain for albumin binding (extending half-life to approximately 50 hours through reduced renal clearance), and a modified peptide backbone for improved chemical stability. The long half-life of glepaglutide enables less frequent dosing (weekly subcutaneous injection) and has been evaluated in phase III clinical trials for SBS.

Research-grade GLP-2 analogs with additional modifications include h[Gly2]GLP-2 with PEGylation for extended circulation, N-terminal modifications (acetylation, D-histidine substitution) for protease resistance, and C-terminal truncations to map the minimal active sequence. The structure-activity relationships indicate that the helical region (residues 7-30) is essential for receptor activation, while the disordered termini primarily influence pharmacokinetic properties. These tools enable researchers to dissect the contribution of specific structural features to GLP-2 biological activity.

Analytical Methods & Detection

Measurement of endogenous GLP-2 in biological samples requires immunoassays with careful attention to specificity. Radioimmunoassays (RIA) and ELISAs using antisera directed against the mid-region or C-terminal epitopes of GLP-2 measure total GLP-2 (intact 1-33 plus the inactive fragment 3-33). N-terminal-specific assays that detect only intact GLP-2(1-33) provide a more physiologically relevant measurement but are technically more challenging. Sample handling requires DPP-IV inhibitors (diprotin A, sitagliptin, or commercial inhibitor cocktails) added at the time of blood collection to prevent ex vivo degradation.

For synthetic GLP-2 and analogs, identity testing by MALDI-TOF-MS or ESI-MS and purity assessment by RP-HPLC (C18 or C8 columns, acetonitrile/water/TFA gradient) are standard quality control measures. Research-grade GLP-2 should meet a purity specification of greater than 95% by HPLC. Peptide content determination by amino acid analysis or UV absorbance (280 nm using the single tryptophan residue at position 25, extinction coefficient ~5,500 M-1cm-1) is recommended for accurate concentration determination in functional assay preparations.

References & Further Reading

The following publications represent key research on GLP-2 biology, intestinal adaptation, and clinical translation through teduglutide development.

Further Reading on ChemVerify

  • Read more: TRH (Thyrotropin-Releasing Hormone): Research Guide & Chemical Profile → https://www.chemverify.com/learn/trh-thyrotropin-releasing-hormone-research-guide
  • Read more: Ipamorelin + CJC-1295 (No DAC) Stack: Synergy Research Guide → https://www.chemverify.com/learn/ipamorelin-cjc-1295-no-dac-stack-synergy
  • Read more: TP508 (Chrysalin): Research Guide & Chemical Profile → https://www.chemverify.com/learn/tp508-chrysalin-research-guide-chemical-profile
  • Read more: Semax for Cognitive Research: ACTH(4-10) Analog Mechanism → https://www.chemverify.com/learn/semax-cognitive-research-acth-mechanism

References

[1]
Drucker DJ, et al. Induction of intestinal epithelial proliferation by glucagon-like peptide 2. Proc Natl Acad Sci USA. 1996;93(15):7911-7916. – PNASPubMed
[2]
Jeppesen PB, et al. Teduglutide (ALX-0600), a dipeptidyl peptidase IV resistant glucagon-like peptide 2 analogue, improves intestinal function in short bowel syndrome patients. Gut. 2005;54(9):1224-1231. – GutPubMed
[3]
Jeppesen PB, et al. Randomised placebo-controlled trial of teduglutide in reducing parenteral nutrition and/or intravenous fluid requirements in patients with short bowel syndrome. Gut. 2011;60(7):902-914. – GutPubMed
[4]
Munroe DG, et al. Prototypic G protein-coupled receptor for the intestinotrophic factor glucagon-like peptide 2. Proc Natl Acad Sci USA. 1999;96(4):1569-1573. – PNASPubMed
[5]
Drucker DJ, Yusta B. Physiology and pharmacology of the enteroendocrine hormone glucagon-like peptide-2. Annu Rev Physiol. 2014;76:561-583. – Annual Review of PhysiologyPubMed
[6]
Benjamin MA, et al. Glucagon-like peptide-2 enhances intestinal epithelial barrier function of both transcellular and paracellular pathways in the mouse. Gut. 2000;47(1):112-119. – GutPubMed
[7]
Sigalet DL, et al. Enteric neural pathways mediate the anti-inflammatory actions of glucagon-like peptide 2. Am J Physiol Gastrointest Liver Physiol. 2007;293(1):G211-G221. – American Journal of PhysiologyPubMed
[8]
Thulesen J, et al. Short-term insulin treatment prevents the diabetogenic action of streptozotocin in rats. Endocrinology. 2004;145(3):1264-1268. – EndocrinologyPubMed
[9]
Schwartz LK, et al. Long-term teduglutide for the treatment of patients with intestinal failure associated with short bowel syndrome. Clin Transl Gastroenterol. 2016;7(2):e142. – Clinical and Translational GastroenterologyPubMed

Compare Verified Vendors

Browse COA-verified suppliers with exclusive discount codes and transparent pricing.

Browse Vendors

You Might Also Like

Continue Reading