Antimicrobial Peptides (AMPs): Research Compound Profiles
Research overview of antimicrobial peptides (AMPs) – naturally occurring defense molecules studied for their membrane-disrupting mechanisms of action. Covers structural classification (alpha-helical, beta-sheet, extended, loop), key research compounds (LL-37, defensins, magainins), mechanism of action models, analytical characterization methods, MIC testing protocols, and antibiotic resistance considerations in laboratory research.

For laboratory research use only. Not for human consumption. This article provides structural and analytical profiles of antimicrobial peptides (AMPs) for research reference purposes. No therapeutic claims, dosage recommendations, or medical advice are provided. AMPs discussed here are characterized by their chemical properties and in vitro microbiological data.
TL;DR: Antimicrobial peptides (AMPs) are a diverse class of naturally occurring defense molecules found across all kingdoms of life, characterized by their ability to disrupt microbial membranes through electrostatic and hydrophobic interactions. Over 3,500 AMPs have been cataloged in the Antimicrobial Peptide Database (APD3), classified into four structural groups: alpha-helical (e.g., LL-37, magainins), beta-sheet (e.g., defensins), extended (e.g., indolicidin), and loop (e.g., bactenecin). Research interest has surged 185% since 2015, driven by the global antibiotic resistance crisis. Analytical characterization requires RP-HPLC purity assessment, CD spectroscopy for secondary structure confirmation, and standardized MIC testing following CLSI/EUCAST protocols.
Last verified: March 2026
What Are Antimicrobial Peptides?
Antimicrobial peptides (AMPs) are a broad class of small proteins, typically 12–50 amino acid residues in length, that function as effector molecules of the innate immune system across virtually all multicellular organisms. AMPs are evolutionarily ancient defense molecules – homologous sequences have been identified in organisms spanning insects (cecropins, Drosophila), amphibians (magainins, Xenopus laevis), plants (thionins, defensins), marine organisms (tachyplesins, horseshoe crab), and mammals (cathelicidins, defensins). This evolutionary conservation across approximately 500 million years of divergent evolution underscores the fundamental importance of peptide-based antimicrobial defense [1].
The Antimicrobial Peptide Database (APD3, https://aps.unmc.edu) catalogs over 3,500 characterized AMPs as of March 2026, with approximately 200–300 new entries added annually. Among cataloged AMPs, approximately 85% are derived from animals, 7% from plants, 5% from bacteria, and 3% from fungi and other sources. The database records key properties including amino acid sequence, three-dimensional structure (when available), spectrum of activity, minimum inhibitory concentration (MIC) values, and structural classification [2].
Research interest in AMPs has increased substantially in the context of the global antimicrobial resistance (AMR) crisis. The WHO identifies AMR as one of the top 10 global public health threats, with an estimated 1.27 million deaths directly attributable to bacterial AMR in 2019. PubMed-indexed AMP research publications increased from approximately 1,900 per year in 2015 to over 5,400 per year in 2025 – a 185% increase reflecting both the urgency of the AMR challenge and the maturation of AMP research tools [3]. The AMP research field has attracted over USD 1.2 billion in funding from public and private sources between 2020 and 2025, according to a Peptide Therapeutics Foundation analysis.
Structural Classification of AMPs
AMPs are classified into four structural groups based on their secondary structure in membrane-mimetic environments. This classification reflects the three-dimensional topology that governs membrane interaction mechanisms rather than sequence homology, as AMPs are remarkably diverse in primary sequence despite convergent structural solutions.
Alpha-helical AMPs represent the largest and best-characterized structural class, comprising approximately 40% of cataloged AMPs. These peptides adopt amphipathic alpha-helical conformations in the presence of lipid membranes or membrane-mimetic solvents (SDS, TFE, DPC micelles), with hydrophobic residues clustered on one face of the helix and cationic residues on the opposing face. This amphipathic topology enables simultaneous electrostatic attraction to anionic bacterial membranes and hydrophobic insertion into the lipid bilayer. Key examples include human cathelicidin LL-37 (37 residues), magainin-2 from Xenopus laevis (23 residues), cecropin A from Hyalophora cecropia (37 residues), and melittin from bee venom (26 residues). Circular dichroism (CD) spectroscopy confirms the alpha-helical conformation, with characteristic minima at 208 nm and 222 nm [4].
Beta-sheet AMPs constitute approximately 30% of cataloged sequences. These peptides are constrained by disulfide bonds (typically 2–4 pairs) that stabilize antiparallel beta-sheet structures. The constraint imposed by disulfide bridges means that beta-sheet AMPs are pre-folded and do not undergo the random-coil-to-structured transition characteristic of alpha-helical AMPs. Human alpha-defensins (HNP-1 through HNP-4, HD-5, HD-6) contain three conserved disulfide bonds (Cys1-Cys6, Cys2-Cys4, Cys3-Cys5) that define a characteristic triple-stranded beta-sheet fold. Beta-defensins (hBD-1 through hBD-4) share the same disulfide connectivity but differ in cysteine spacing. Protegrins, tachyplesins, and polyphemusins are additional beta-sheet AMP families with characteristic hairpin structures stabilized by two disulfide bonds [5].
Extended AMPs (approximately 15% of cataloged sequences) lack classical secondary structure elements and instead adopt extended or polyproline II-like conformations. These peptides are typically enriched in specific amino acid residues – tryptophan, proline, arginine, or histidine – that contribute to membrane interaction through non-classical mechanisms including aromatic insertion, proline-induced kinking, and electrostatic charge clustering. Indolicidin (13 residues, 5 tryptophans) and tritrpticin (13 residues, 3 tryptophans) are prototypical examples. Loop AMPs (approximately 15%) are constrained by a single disulfide bond into a loop structure – bactenecin (12 residues, 1 disulfide) is the most studied example [4].
Mechanism of Action: Membrane Disruption Models
AMP membrane disruption mechanisms are described by several models that are not mutually exclusive – different AMPs may employ different mechanisms, and individual AMPs may operate through multiple mechanisms depending on concentration and membrane composition. The selectivity of AMPs for bacterial over mammalian membranes is driven by a fundamental biophysical difference: bacterial membranes are enriched in anionic phospholipids (phosphatidylglycerol, cardiolipin, phosphatidylserine) presenting a net negative surface charge, while mammalian cell membranes are composed primarily of zwitterionic phospholipids (phosphatidylcholine, sphingomyelin) with neutral or weakly negative surface charge. This charge asymmetry provides the basis for selective AMP-membrane interaction [6].
The barrel-stave model describes AMP monomers inserting perpendicular to the membrane plane and oligomerizing into transmembrane pores with hydrophobic faces contacting lipid acyl chains and hydrophilic faces lining the aqueous pore lumen. This model applies primarily to strongly hydrophobic, helical AMPs such as alamethicin, which forms voltage-dependent channels with defined conductance states observable by electrophysiology. The toroidal pore (wormhole) model describes AMPs inserting at an angle and inducing positive membrane curvature, such that the lipid headgroups bend continuously from the outer to inner leaflet, creating a pore lined by both peptide and lipid headgroups. Magainin-2 is the prototypical toroidal pore-forming AMP, with neutron diffraction studies confirming lipid headgroup participation in the pore structure [6].
The carpet model describes AMPs accumulating on the membrane surface in a parallel orientation at sub-lytic concentrations, then disrupting the membrane in a detergent-like manner when a critical surface concentration is reached (typically 10^8–10^9 peptide molecules per bacterium). This model applies to many cationic AMPs including cecropins and dermaseptins. The molecular electroporation model, proposed more recently, suggests that AMPs create transient membrane potential asymmetries that trigger electropore formation. Aggregate channel models describe loosely organized AMP clusters creating transient pores without the defined stoichiometry of barrel-stave or toroidal pores [7]. In vitro biophysical studies using model membrane systems (large unilamellar vesicles, supported lipid bilayers, giant unilamellar vesicles) provide mechanistic data, but researchers should note that model membrane results may not fully recapitulate the complexity of intact bacterial cell envelopes.
LL-37: Human Cathelicidin Profile
LL-37 is the sole human cathelicidin antimicrobial peptide, a 37-residue cationic peptide (MW 4,493.3 Da, net charge +6 at pH 7.4) with the sequence [LL-37, 37 aa] It is produced by proteolytic cleavage of the 18 kDa precursor protein hCAP-18 (human cationic antimicrobial protein of 18 kDa) by proteinase 3 in neutrophils and by kallikrein-related peptidases in epithelial tissues. LL-37 is expressed in neutrophils (stored in specific granules at concentrations of approximately 630 micrograms per 10^9 cells), epithelial cells of the skin, respiratory tract, gastrointestinal tract, and urogenital tract, as well as in wound fluid and inflammatory exudates [8].
Structurally, LL-37 adopts an amphipathic alpha-helical conformation in the presence of anionic lipids or membrane-mimetic environments. NMR and X-ray crystallography studies reveal a curved helix spanning residues 2–31 with a hydrophobic face (Leu, Phe, Ile, Val residues) and a cationic face (Lys, Arg residues). The N-terminal residues (LL) and C-terminal tail (RTES) are relatively disordered. The amphipathic helix has a calculated hydrophobic moment of 0.52 (on the Eisenberg scale), placing it in the range typical of membrane-active peptides. CD spectroscopy in the presence of SDS micelles shows characteristic alpha-helical minima at 208 and 222 nm, with a helical content of approximately 70–80% [8].
LL-37 has been reported to exhibit broad-spectrum antimicrobial activity in vitro against both Gram-positive and Gram-negative bacteria, with MIC values typically ranging from 1 to 64 micrograms/mL depending on the bacterial strain and assay conditions. Published MIC values include: Escherichia coli (2–16 micrograms/mL), Staphylococcus aureus (8–64 micrograms/mL), Pseudomonas aeruginosa (4–32 micrograms/mL), and Klebsiella pneumoniae (8–32 micrograms/mL) [9]. However, MIC values are highly sensitive to assay conditions – salt concentration, serum components, pH, and bacterial inoculum density all significantly affect measured activity. MIC values determined in Mueller-Hinton broth without supplementation may not reflect activity in physiological environments where salt concentrations (150 mM NaCl) can reduce LL-37 activity by 4–16-fold.
AMP Research Compound Comparison
| Property | LL-37 | HNP-1 (α-defensin) | Magainin-2 | Nisin | Polymyxin B |
|---|---|---|---|---|---|
| Amino Acid Count | 37 | 30 | 23 | 34 (precursor) | ~1,200 Da (lipopeptide) |
| Molecular Weight | 4,493 Da | 3,442 Da | 2,467 Da | 3,354 Da | 1,203 Da |
| Net Charge (pH 7) | +6 | +3 | +4 | −7 to −4 | +5 |
| Structural Class | Alpha-helical | Beta-sheet (3 S-S) | Alpha-helical | Polycyclic | Cyclic lipopeptide |
| Source Organism | Homo sapiens | Homo sapiens | Xenopus laevis | Lactococcus lactis | Paenibacillus polymyxa |
| MIC vs E. coli | 2–16 µg/mL | 1–8 µg/mL | 2–8 µg/mL | >128 µg/mL (Gram-neg) | 0.5–2 µg/mL |
| MIC vs S. aureus | 8–64 µg/mL | 1–4 µg/mL | 16–64 µg/mL | 0.5–4 µg/mL | 8–32 µg/mL |
| Salt Sensitivity | High | Moderate | High | Low | Low |
| Primary Research Use | Human innate immunity | Innate immunity | Model AMP | Food preservation | Last-resort antibiotic research |
Defensins & Magainins: Key Research Compounds
Human alpha-defensins (HNP-1 through HNP-4, also designated human neutrophil peptides) are 29–30 amino acid residues in length with three conserved intramolecular disulfide bonds that define a compact triple-stranded beta-sheet structure. HNP-1 (MW 3,442 Da, sequence ACYCRIPACIAGERRYGTCIYQGRLWAFCC) is the most abundant antimicrobial peptide in human neutrophils, constituting approximately 5–7% of total neutrophil protein (roughly 12 micrograms per 10^6 neutrophils). The three disulfide bonds (Cys2-Cys30, Cys4-Cys19, Cys9-Cys29) are essential for structural integrity and antimicrobial activity – reduction of any single disulfide reduces activity by 80–95% [5].
Human beta-defensins (hBD-1 through hBD-4) are expressed primarily by epithelial tissues and differ from alpha-defensins in disulfide connectivity pattern (Cys1-Cys5, Cys2-Cys4, Cys3-Cys6 vs. Cys1-Cys6, Cys2-Cys4, Cys3-Cys5 for alpha-defensins). hBD-1 is constitutively expressed in epithelial cells, while hBD-2 and hBD-3 are inducible by bacterial lipopolysaccharide (LPS), inflammatory cytokines (TNF-alpha, IL-1beta), and TLR agonists. hBD-3 is notable for its retained activity at physiological salt concentrations (150 mM NaCl), unlike most other AMPs – this salt-resistance is attributed to its unusually high positive charge (+11 at pH 7) and compact disulfide-stabilized structure [5].
Magainins are 23-residue alpha-helical AMPs first isolated from the skin secretions of the African clawed frog Xenopus laevis by Zasloff in 1987 – a landmark discovery that catalyzed the modern AMP research field. Magainin-2 (GIGKFLHSAKKFGKAFVGEIMNS, MW 2,467 Da) has served as a model AMP for biophysical studies of membrane interaction mechanisms for nearly four decades. Its mechanism of action has been extensively characterized by solid-state NMR, neutron diffraction, and molecular dynamics simulations, establishing the toroidal pore model. Magainin-2 analogs – particularly MSI-78 (pexiganan), a 22-residue synthetic analog with improved potency – have been subjects of research programs for topical antimicrobial applications [10].
Analytical Characterization Methods
Analytical characterization of AMPs requires a multi-technique approach addressing identity, purity, secondary structure, and biological activity. Identity confirmation by ESI-MS or MALDI-TOF mass spectrometry is the primary quality control step, with expected monoisotopic masses calculated from the amino acid sequence accounting for disulfide bonds (minus 2 Da per bond) and C-terminal amidation (minus 1 Da) where applicable. For disulfide-containing AMPs (defensins, protegrins), comparison of masses under reducing and non-reducing conditions confirms correct disulfide bond formation – misfolded isomers with incorrect disulfide pairing have different chromatographic retention times and biological activities [11].
Circular dichroism (CD) spectroscopy is essential for confirming the secondary structure of AMPs in membrane-mimetic environments. Standard CD protocols measure spectra from 190 to 260 nm in aqueous buffer (random coil reference) and in the presence of SDS micelles (20–30 mM), TFE (30–50% v/v), or lipid vesicles (POPC/POPG). Alpha-helical AMPs show characteristic double minima at 208 and 222 nm, with the ratio [theta]222/[theta]208 providing information about helix-helix interactions. Beta-sheet AMPs show a single minimum near 215–218 nm and a positive band near 195 nm. Deconvolution algorithms (CONTIN, SELCON3, CDSSTR) estimate secondary structure composition from CD spectra with typical accuracy of plus or minus 5–10% [12].
RP-HPLC purity assessment for AMPs follows standard peptide analytical protocols: C18 columns with 0.1% TFA/acetonitrile gradients, UV detection at 214 nm (amide bond absorption) or 280 nm (aromatic residues, applicable for Trp/Tyr-containing AMPs). Purity specifications for research-grade AMPs are typically 95% or greater by HPLC area percentage. For AMPs with free cysteine residues or susceptibility to oxidation (Met, Trp), accelerated stability studies under thermal and oxidative stress conditions should be performed to establish storage recommendations and identify degradation products.
MIC Testing Methods & Standardization
Minimum inhibitory concentration (MIC) testing for AMPs requires careful attention to methodology, as AMP activity is highly sensitive to assay conditions that do not significantly affect conventional antibiotic MIC values. The Clinical and Laboratory Standards Institute (CLSI) broth microdilution method (M07-A11) and EUCAST guidelines provide the standard framework, but specific adaptations are required for peptide testing: (1) use of polypropylene microplates rather than polystyrene to minimize peptide adsorption – published studies demonstrate 2–8-fold MIC reductions when switching from polystyrene to polypropylene plates due to reduced surface binding losses [13]; (2) avoidance of Mueller-Hinton broth supplementation with Ca2+ and Mg2+ cations, which can compete with AMP-membrane electrostatic interactions; and (3) use of low-salt media or explicit reporting of NaCl concentration, as physiological salt reduces the activity of many cationic AMPs.
Bacterial inoculum standardization follows CLSI recommendations: 5 x 10^5 CFU/mL final concentration, prepared from mid-logarithmic phase cultures (OD600 = 0.4–0.6) diluted to the target density. MIC is defined as the lowest AMP concentration that prevents visible bacterial growth after 16–20 hours of incubation at 37 degrees Celsius. Minimum bactericidal concentration (MBC) is determined by subculturing 10 microliters from MIC-clear wells onto agar plates and incubating for 24 hours – the MBC is the lowest concentration producing 99.9% kill (3-log reduction) relative to the initial inoculum. The MBC/MIC ratio provides information about killing kinetics: ratios of 1–2 indicate bactericidal activity (typical for membrane-disrupting AMPs), while ratios exceeding 4 suggest bacteriostatic mechanisms.
Time-kill kinetics provide additional mechanistic information beyond endpoint MIC values. AMP killing kinetics are typically rapid – membrane-disrupting AMPs achieve 99.9% kill within 15–60 minutes at 4x MIC, compared to 4–24 hours for many conventional antibiotics. Time-kill curves are constructed by sampling bacterial cultures exposed to AMP at defined intervals (0, 15, 30, 60, 120, 240 minutes), plating serial dilutions for CFU enumeration, and plotting log10 CFU/mL versus time. A 3-log reduction within 60 minutes at the tested concentration is generally considered rapid bactericidal activity [13].
Resistance Considerations in AMP Research
AMP resistance mechanisms exist but differ fundamentally from conventional antibiotic resistance in both mechanism and frequency of emergence. Because AMPs target the bacterial membrane – a structure essential for cell viability that cannot be eliminated through single-gene mutations – resistance development through target modification is inherently constrained. Serial passage experiments demonstrate that bacteria develop resistance to AMPs 100–1,000-fold more slowly than to conventional antibiotics: E. coli develops 4-fold resistance to magainin-2 after 600–700 generations of serial passage, compared to 64–256-fold resistance to ciprofloxacin after 20–30 generations [14].
Known AMP resistance mechanisms include: (1) modification of membrane lipid composition – aminoarabinose modification of lipid A (mediated by arnBCADTEF operon) reduces the net negative charge of Gram-negative outer membranes, decreasing electrostatic AMP attraction; (2) increased expression of efflux pumps – the MtrCDE and AcrAB-TolC systems can export certain AMPs from the periplasm; (3) production of extracellular proteases – degradation of AMPs before membrane contact (less effective against protease-resistant D-amino acid-containing or cyclic AMPs); (4) capsule and biofilm production – physical barriers that sequester AMPs and reduce local concentrations at the membrane surface; and (5) release of anionic decoy molecules (e.g., alginate, hyaluronic acid) that bind and neutralize cationic AMPs [14].
The resistance consideration has important implications for AMP research design: serial passage experiments should include appropriate controls (conventional antibiotics for comparison), use standardized passage protocols (typically 1/2 MIC sub-inhibitory pressure for 30+ days), and report both MIC fold-change and reversion rates upon removal of selective pressure. The general finding across the literature is that AMP resistance emerges more slowly, achieves lower fold-increases, and reverts more rapidly than conventional antibiotic resistance – though this generalization has exceptions for specific AMP-pathogen combinations and should be validated experimentally for each compound under study.
Frequently Asked Questions
What makes AMPs selective for bacterial over mammalian cells?
AMP selectivity is driven primarily by membrane charge asymmetry. Bacterial membranes contain 20–30% anionic phospholipids (phosphatidylglycerol, cardiolipin) presenting a net negative surface charge that electrostatically attracts cationic AMPs (net charge typically +2 to +9). Mammalian cell membranes are composed predominantly of zwitterionic phospholipids (phosphatidylcholine, sphingomyelin) with cholesterol (up to 45 mol%) that further reduces AMP insertion. The selectivity ratio – defined as the ratio of hemolytic concentration (HC50 against human erythrocytes) to MIC against target bacteria – provides a quantitative measure; research-relevant AMPs typically have selectivity ratios above 10, with optimized analogs achieving ratios of 100 or greater.
How do researchers verify correct disulfide bond pairing in defensins?
Correct disulfide bond pairing in defensins is verified through a combination of analytical techniques: (1) tryptic or chymotryptic digestion under non-reducing conditions, followed by LC-MS/MS identification of disulfide-linked peptide fragments – each disulfide isomer produces a distinct set of cross-linked fragments; (2) chemical modification using iodoacetamide (IAM) or N-ethylmaleimide (NEM) to alkylate free cysteines – correct folding yields a product with zero free cysteines, while misfolded isomers may have detectable free thiol content by Ellman's assay; (3) RP-HPLC comparison with authenticated reference standards – different disulfide isomers have distinct retention times; and (4) NMR spectroscopy (NOESY cross-peaks between cysteine alpha-protons confirm spatial proximity consistent with bonded pairs).
Why are AMP MIC values so variable between publications?
AMP MIC variability between publications reflects assay condition sensitivity that exceeds that of conventional antibiotics. Key variables include: (1) salt concentration – 150 mM NaCl reduces activity of many cationic AMPs by 4–16-fold versus low-salt media; (2) plate material – polystyrene adsorbs AMPs, artificially increasing apparent MIC by 2–8-fold versus polypropylene; (3) serum components – serum proteins bind AMPs, reducing free concentrations; (4) inoculum density – higher bacterial loads require proportionally more AMP; (5) growth phase – stationary phase bacteria are often more resistant than log-phase cells; (6) peptide quality – purity, counterion (TFA vs acetate), and net peptide content all affect the true active concentration. Standardized reporting following CLSI guidelines with explicit documentation of all assay parameters is essential for meaningful cross-study comparisons.
What structural modifications improve AMP stability for research use?
Common stability modifications for AMP research analogs include: (1) D-amino acid substitution – replacing L-residues with D-enantiomers at protease-susceptible positions confers resistance to serum proteases while often preserving antimicrobial activity (activity may change if specific L-stereocenters are critical for membrane interaction geometry); (2) C-terminal amidation – improves helicity, increases net positive charge by +1, and removes the C-terminal carboxylate vulnerable to carboxypeptidase degradation; (3) cyclization – backbone cyclization through head-to-tail amide bonds or disulfide bridges increases conformational stability and reduces both N-terminal aminopeptidase and C-terminal carboxypeptidase degradation; (4) N-terminal acetylation – blocks aminopeptidase degradation; and (5) unnatural amino acid incorporation – Aib (alpha-aminoisobutyric acid) promotes helicity and resists proteolysis.
What is the current status of AMP research toward practical applications?
As of March 2026, the AMP research pipeline includes approximately 30 peptide-based antimicrobial compounds in various stages of preclinical and clinical investigation globally. Nisin is approved for food preservation applications in over 50 countries (E234 in the EU). Polymyxin B and colistin (polymyxin E) are established clinical antibiotics used as last-resort agents for multidrug-resistant Gram-negative infections. Pexiganan (MSI-78, a magainin-2 analog) completed Phase III clinical trials for topical applications but was not approved by the FDA. Surotomycin (a cyclic lipopeptide) reached Phase III for C. difficile infection. Multiple AMPs are in Phase I–II clinical trials for various applications. The primary challenges limiting clinical translation include manufacturing cost (SPPS for long AMPs is expensive at scale), serum stability, systemic toxicity, and the regulatory pathway for novel antimicrobial classes.
Next Steps
Explore ChemVerify's AMP compound database for detailed structural profiles, batch-level purity data, and verified vendor comparisons for LL-37, defensins, magainins, and other antimicrobial peptide research compounds. Access analytical characterization data and CoA verification at ChemVerify.io/compounds.
Compounds Referenced in This Article
Explore detailed chemical profiles and research guides for compounds discussed in this article:
- LL-37: Complete Research Guide → /learn/ll-37-research-guide-chemical-profile
Further Reading on ChemVerify
- Read more: GLP-1 Receptor Agonist Peptides: Research Compound Analysis → https://www.chemverify.com/learn/weight-loss-peptides-research
- Read more: Peptides in Women's Health Research: Compound Profiles & Analysis → https://www.chemverify.com/learn/womens-peptide-research
- Read more: Peptide Mimetics: Non-Peptide Analogs in Research → https://www.chemverify.com/learn/peptide-mimetics-overview
- Read more: Growth Hormone Releasing Peptides: Research Compound Overview → https://www.chemverify.com/learn/growth-hormone-peptides-overview
References
Compare Verified Vendors
Browse COA-verified suppliers with exclusive discount codes and transparent pricing.
Continue Reading
Peptide Mimetics: Non-Peptide Analogs in Research
Comprehensive research overview of peptidomimetics – non-peptide analogs designed to replicate peptide biological activity with improved pharmacokinetic properties. Covers Type I–III classification, structural design strategies, oral bioavailability advantages, analytical characterization methods (HPLC, LC-MS/MS), and current research applications in drug design.
Peptides in Women's Health Research: Compound Profiles & Analysis
Research-focused compound profiles of peptides studied in women's health contexts. Covers kisspeptin (reproductive endocrinology research), oxytocin (neuropeptide signaling), BPC-157 (tissue repair models), GHK-Cu (copper peptide biochemistry), and PT-141 (melanocortin receptor pharmacology). Structural profiles, analytical characterization, and amino acid sequences only – no therapeutic claims.
GLP-1 Receptor Agonist Peptides: Research Compound Analysis
Analytical overview of GLP-1 receptor agonist research peptides including Semaglutide, Tirzepatide, Retatrutide, Liraglutide, and AOD-9604. Covers receptor binding profiles (GLP-1, GIP, glucagon), acylation chemistry, molecular weights, published clinical trial references, and analytical characterization methods.
Growth Hormone Releasing Peptides: Research Compound Overview
Comprehensive analytical overview of growth hormone releasing peptides including GHRH analogs, GHRPs, and growth hormone secretagogues. Covers molecular structures, amino acid sequences, molecular weights, purity testing methods, and storage requirements for CJC-1295, Ipamorelin, GHRP-6, GHRP-2, MK-677, and Sermorelin.
